Name :
BRUNOL4 (Human) Recombinant Protein (P01)
Biological Activity :
Human BRUNOL4 full-length ORF (no protein_acc, 1 a.a. – 250 a.a.) recombinant protein with GST tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
no protein_acc
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=56853
Amino Acid Sequence :
MNRPIQVKPADSESRGDRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQTMPVSAGPLGRGRGQRRAETPAPATPRRLSSLPKRQESMTLIPGLRQGRGSPGMLRNWPEVTQVENARGGVHTSFPWASADAASSKAPRGAGGVGAGQRHRQLRAEALEQVGLTRRPGRREPRPVWWSSSPTPTRSARCGECSRWLARWACSTPWPSLSGPTAPTLRQ
Molecular Weight :
53.59999999999999
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Interspecies Antigen Sequence :
Mouse (95)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，
Gene Name :
BRUNOL4
Gene Alias :
BRUNOL-4, CELF4
Gene Description :
bruno-like 4, RNA binding protein (Drosophila)
Gene Summary :
Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations :
Bruno -like 4, RNA binding protein|CUG-BP and ETR-3 like factor 4|LYST-interacting protein LIP9|RNA-binding protein BRUNOL4|bruno-like 4, RNA binding protein
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Dkk-1 Proteinsite
IFN-beta ProteinStorage & Stability
Popular categories:
SMAD2
Fc Receptor-like A